Scaffold Ga0315270_10036175

Overview

Basic Information

• Taxon OID: 3300032275
• Scaffold ID: Ga0315270_10036175
• Source Dataset Name: Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2733
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (71.43%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Extremophilic Microbial Mat Communities From Usa And Mexico

Source Dataset Sampling Location

• Location Name: USA: Wyoming
• Coordinates
  • Lat. (^o): 44.5106
  • Long. (^o): -110.3566
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026423	Metagenome / Metatranscriptome	198	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0315270_100361755	F026423	GGAGG	MLSLLVSVGCAAPSKHQSTTVGLHCTISWDKTNDPKVTGYQITVIDQSKQAKKIVRFIPSNTVKISCKDAGADHEGLWDVTVQSCYDKSTCGPPTEAARMHITAK