Scaffold Ga0316195_10184303

Overview

Basic Information

• Taxon OID: 3300032263
• Scaffold ID: Ga0316195_10184303
• Source Dataset Name: Coastal sediment microbial communities from Maine, United States - Phippsburg sediment 1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1095
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Sediment → Sediment → Sediment Chemolithoautotrophic Microbial Communities From Various Locations

Source Dataset Sampling Location

• Location Name: USA: Maine
• Coordinates
  • Lat. (^o): 43.8293
  • Long. (^o): -69.8133
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059979	Metagenome / Metatranscriptome	133	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0316195_101843031	F059979	AGGAG	MKSFLFVLSQLTLVTIVYAFAYRAGYRNAQSRAMSVVRKFADPVTCLLDQLNESIEEAKEDDQEQ