| Basic Information | |
|---|---|
| Taxon OID | 3300032259 Open in IMG/M |
| Scaffold ID | Ga0316190_11042649 Open in IMG/M |
| Source Dataset Name | Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 535 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow → Sediment Chemolithoautotrophic Microbial Communities From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Maine | |||||||
| Coordinates | Lat. (o) | 43.9948 | Long. (o) | -69.6486 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F045540 | Metagenome | 152 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0316190_110426491 | F045540 | N/A | DSKSRIKKHYSPDTIIFDLLDENLDEIDFIKSLSELELIYGFEIPEELYDKTDLTLEQFAYELSLLPVISDELYPDFFDVKFTAMKLTKRAIELEVKTDKESIKELNEINAEFEELTTRLNMVLENNYDQELLVN |
| ⦗Top⦘ |