Scaffold Ga0316209_1037516

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0316209_1037516

Scaffold Ga0316209_1037516

Overview

Basic Information
Taxon OID	3300032255 Open in IMG/M
Scaffold ID	Ga0316209_1037516 Open in IMG/M
Source Dataset Name	Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month chalcopyrite
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1649
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat → Sediment Chemolithoautotrophic Microbial Communities From Various Locations

Source Dataset Sampling Location
Location Name	USA: Maine
Coordinates	Lat. (^o)	43.8603	Long. (^o)	-69.5781	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F038249	Metagenome / Metatranscriptome	166	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0316209_10375161	F038249	AGGA	MIPSSFRGTLVPTYVKSKTQLVAWALEEFKDSDPITNWEFVRELYCHRFGGILFNLRQEGYEITTLKTKTKGLVSYYCTKVPSRTTI

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.