Scaffold Ga0316198_10754427

Overview

Basic Information

• Taxon OID: 3300032251
• Scaffold ID: Ga0316198_10754427
• Source Dataset Name: Coastal sediment microbial communities from Oude Bieten Haven, Netherlands - site A anoxic
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 518
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Sediment → Sediment → Sediment Chemolithoautotrophic Microbial Communities From Various Locations

Source Dataset Sampling Location

• Location Name: Netherlands
• Coordinates
  • Lat. (^o): 51.4666
  • Long. (^o): 4.071
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030291	Metagenome / Metatranscriptome	186	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0316198_107544271	F030291	N/A	PRGILQDIIKLRAMSGEEIKEYFQKRADFHNSNPKNRFYGRTAKEWAIDQEKWHSLKNERTYSKHFE