Scaffold Ga0316187_10009590

Overview

Basic Information

• Taxon OID: 3300032231
• Scaffold ID: Ga0316187_10009590
• Source Dataset Name: Coastal sediment microbial communities from Maine, United States - Cross River worm burrow 1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 8245
• Total Scaffold Genes: 11
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 9 (81.82%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow → Sediment Chemolithoautotrophic Microbial Communities From Various Locations

Source Dataset Sampling Location

• Location Name: USA: Maine
• Coordinates
  • Lat. (^o): 43.917
  • Long. (^o): -69.6219
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F085722	Metagenome	111	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0316187_1000959010	F085722	GAGG	MLRIAFVSVCYVLLVIGQIGCSNPHKEAARASTEASKAEAGVHNEKAKILEDYRKCLNKNKSNEQACESYKRALDSM