Scaffold Ga0316187_10000447

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0316187_10000447

Scaffold Ga0316187_10000447

Overview

Basic Information
Taxon OID	3300032231 Open in IMG/M
Scaffold ID	Ga0316187_10000447 Open in IMG/M
Source Dataset Name	Coastal sediment microbial communities from Maine, United States - Cross River worm burrow 1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	31950
Total Scaffold Genes	34 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	15 (44.12%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow → Sediment Chemolithoautotrophic Microbial Communities From Various Locations

Source Dataset Sampling Location
Location Name	USA: Maine
Coordinates	Lat. (^o)	43.917	Long. (^o)	-69.6219	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F070130	Metagenome / Metatranscriptome	123	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0316187_1000044715	F070130	AGG	MTKVREIPDTPARQPDFFVGWWEIVFHIRDGEQTDVTGIIEHVDAAGRFTVFRDGERIGAGHHVEFTVDPDAFTNVQEVAGAHKQIGRELAVYRFSGDVLEVCKASEHTGRPTSFASPRGSGWTHVAIRRISDDDPRIRAQR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.