NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315268_10207753

Scaffold Ga0315268_10207753


Overview

Basic Information
Taxon OID3300032173 Open in IMG/M
Scaffold IDGa0315268_10207753 Open in IMG/M
Source Dataset NameSediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1874
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Extremophilic Microbial Mat Communities From Usa And Mexico

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5106Long. (o)-110.3566Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006468Metagenome / Metatranscriptome372Y
F098717Metagenome103Y

Sequences

Protein IDFamilyRBSSequence
Ga0315268_102077531F098717N/ACTHFLSESQNYFVDEKGRFSDPDDCIDSCRYALLACLQGIAEPWDNKTPAERMRNQRDRYVTRDYSNKTATKQIYNPGD
Ga0315268_102077535F006468AGGAMLDIKHIPVSDINQNNKTNARFVRMKNQMDVKMASYLRYLGTKNAVNRASDYHYLCLAVTDSTAPVNGIDYIHPSVKPVVDYATAVIAKGLMPNGEVNFEFVADGSEDEVAARQATDMVSKVVNNMNDPHFILERWVMDACMHKNGMMMIKPVREQVTRYIDTEGTLDQLRAFEQQAADSGLTALRQSKRRTTVDMMKVMDEVETLLGDNQKEFAMEQINSTLDKFKQLPEETDQEDRSQELLGQYVGDQASILD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.