Scaffold Ga0224413_11792262

Overview

Basic Information

• Taxon OID: 3300032167
• Scaffold ID: Ga0224413_11792262
• Source Dataset Name: Three Goat Fecal Pellets
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 677
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium DNF00626 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Goat Feces → Determining The Genomic Basis For Interactions Between Gut Fungi And Methanogenic Archaea

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 34.4204
  • Long. (^o): -119.6671
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050059	Metagenome / Metatranscriptome	145	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0224413_117922621	F050059	N/A	ALTFKPRIDSNHGGTWDSPVGKLRGKASRGKHRSLDPREGKRDTAATARGESAGAFPHTRRGLTPLGRLQKYPKIHVSTGEESSGSGTDFTQGLRPRHRRERNPERPTSNSHGDWPFLRPPERVPEVPVVSREHLPQLEKIQEVLPSRRDEAHFR