NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0272424_1010442

Scaffold Ga0272424_1010442


Overview

Basic Information
Taxon OID3300032162 Open in IMG/M
Scaffold IDGa0272424_1010442 Open in IMG/M
Source Dataset NameRock endolithic microbial communities from Victoria Land, Antarctica - Pudding Butte nord
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)12354
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (28.57%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Opisthokonta(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock → Rock Endolithic Microbial Communities From Victoria Land, Antarctica

Source Dataset Sampling Location
Location NameAntarctica: Victoria Land
CoordinatesLat. (o)-75.8Long. (o)159.9Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F058565Metagenome134Y

Sequences

Protein IDFamilyRBSSequence
Ga0272424_10104421F058565AGGVNLKDDETMMNCMNYSNADSKTIASDVDLSQENKDVRSKCLCNDEENIANIIDLLIKISTLEKEKSKDYS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.