NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0311301_10085444

Scaffold Ga0311301_10085444


Overview

Basic Information
Taxon OID3300032160 Open in IMG/M
Scaffold IDGa0311301_10085444 Open in IMG/M
Source Dataset NameSb_50d combined assembly (MetaSPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6398
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (88.89%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil → Peatlands Soil Microbial Communities From Germany And Austria, That Are Sulfate Reducing

Source Dataset Sampling Location
Location NameGermany: Weissenstadt
CoordinatesLat. (o)50.1318Long. (o)11.881Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016585Metagenome / Metatranscriptome246Y
F047836Metagenome / Metatranscriptome149Y

Sequences

Protein IDFamilyRBSSequence
Ga0311301_100854445F016585AGGAGGMECKAQWRAISSGDGASLFSSAVFVAVAALLAVSALCLLPGLGTLEMALPGAGRLALAVTVMVLGFSGVLASTLLNLPDTMRRMLVMLFATALLCSGFVALVGWFAVSGASGCWL
Ga0311301_100854449F047836N/AAGRLHARELIVELNRAYSRSAVRRWVAVGVIAGSGLVVLGVGLGMVLARVLK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.