Basic Information | |
---|---|
Taxon OID | 3300032159 Open in IMG/M |
Scaffold ID | Ga0268251_10140488 Open in IMG/M |
Source Dataset Name | Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 901 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave → Agave Microbial Communities From California, Usa, And Mexico |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Guanajuato, Mexico | |||||||
Coordinates | Lat. (o) | 21.7658 | Long. (o) | -100.163 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F064247 | Metagenome | 128 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0268251_101404881 | F064247 | N/A | MLISVREMDTGIFVVLPFRGRKLVRDFGGEGGTKSLRFFSKSSAINEFGIPLSTTV |
⦗Top⦘ |