Scaffold Ga0316201_10599776

Overview

Basic Information

• Taxon OID: 3300032136
• Scaffold ID: Ga0316201_10599776
• Source Dataset Name: Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrow
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 941
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Oricola → Oricola cellulosilytica (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow → Sediment Chemolithoautotrophic Microbial Communities From Various Locations

Source Dataset Sampling Location

• Location Name: USA: Delaware
• Coordinates
  • Lat. (^o): 38.7869
  • Long. (^o): -75.1074
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F073087	Metagenome	120	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0316201_105997761	F073087	N/A	MNTQHKTSFTKAILGSTQRLFRSNKNNLLASNHIDAHTLRDIGINTVGLN