Scaffold Ga0316201_10054040

Overview

Basic Information

• Taxon OID: 3300032136
• Scaffold ID: Ga0316201_10054040
• Source Dataset Name: Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrow
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3486
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (62.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow → Sediment Chemolithoautotrophic Microbial Communities From Various Locations

Source Dataset Sampling Location

• Location Name: USA: Delaware
• Coordinates
  • Lat. (^o): 38.7869
  • Long. (^o): -75.1074
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F012861	Metagenome	276	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0316201_100540405	F012861	N/A	MKEFDRIRQKLIDLEEIDFTPEEYHLVFQMAGYDLLNHSEMRTLILAFCEKLNPELSPREYSNIKDHHVDLPE