Scaffold Ga0315339_1007461

Overview

Basic Information

• Taxon OID: 3300032134
• Scaffold ID: Ga0315339_1007461
• Source Dataset Name: Ammonia-oxidizing marine archaeal communities from Pacific Ocean, United States - ASW #17
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 6303
• Total Scaffold Genes: 10
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 8 (80.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 36.1202
  • Long. (^o): -123.4856
  • Depth (m): 200

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025302	Metagenome / Metatranscriptome	202	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0315339_10074614	F025302	GAG	VNWLSAITAVSRLFSSLAGLYRDWRLRSAGPQAARLAALEAGQARAKRMAEITAHLDRLDDAELDRRLRHYRRTSSRVRMD