Scaffold Ga0315336_1140322

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0315336_1140322

Scaffold Ga0315336_1140322

Overview

Basic Information
Taxon OID	3300032132 Open in IMG/M
Scaffold ID	Ga0315336_1140322 Open in IMG/M
Source Dataset Name	Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - ASW #5
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	968
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing

Source Dataset Sampling Location
Location Name	USA: California
Coordinates	Lat. (^o)	36.7507	Long. (^o)	-122.0138	Alt. (m)		Depth (m)	200
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F075426	Metagenome / Metatranscriptome	119	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0315336_11403223	F075426	AGGAGG	MKIKELIQQVEHLMGRQPEGYMIRLINDGLLDISATKKEYTVSAKTDLLKKKRWYTLDDQAIDVTKVEILDTNSRYVMIPKLADSHRLLREDTDAGDETLA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.