NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315333_10050188

Scaffold Ga0315333_10050188


Overview

Basic Information
Taxon OID3300032130 Open in IMG/M
Scaffold IDGa0315333_10050188 Open in IMG/M
Source Dataset NameAmmonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 34915
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1865
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (55.56%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)36.7468Long. (o)-122.0193Alt. (m)Depth (m)200
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016014Metagenome / Metatranscriptome250Y
F046430Metagenome / Metatranscriptome151Y
F089027Metagenome / Metatranscriptome109Y

Sequences

Protein IDFamilyRBSSequence
Ga0315333_100501881F046430AGGAMIERGQTREVPPERKTVAVEGISGILSEPRHGCGRNISVVFYT
Ga0315333_100501882F016014N/AMSIEVTQDAINQMNHILEKNGDAAVRYELKAGGCGGIIAEWGTEPHHKPSQGEQTWPLANGLFVMDEFTKDFIDGGIVNYDLTNFMPNFIVSVPGKGQCGCGSSFVVG
Ga0315333_100501889F089027N/AMSIEVTQDAINQMNHILEKNGDAAVRYELKAGGCGGIIAEWGTEPHHEPEQGEQTWPLTNGVFVMDEFT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.