NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315277_10703683

Scaffold Ga0315277_10703683


Overview

Basic Information
Taxon OID3300032118 Open in IMG/M
Scaffold IDGa0315277_10703683 Open in IMG/M
Source Dataset NameSediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)972
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Extremophilic Microbial Mat Communities From Usa And Mexico

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5099Long. (o)-110.3566Alt. (m)Depth (m)103
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021092Metagenome / Metatranscriptome220N
F052474Metagenome / Metatranscriptome142N

Sequences

Protein IDFamilyRBSSequence
Ga0315277_107036832F052474N/AVNNVIFNIMSDKEKILNAINKLAKLDPSLGENLSKLAELAEKKPFIYQQAIKQLNSL
Ga0315277_107036833F021092N/ASRKLINMTDPHYILEYMQDNDLRYFQVANQFNRDVVVSFNDRSLEDGVEKMRKFLSKNTGFHRIKLYTNNDLKANGIPRQEPQVFEVSITGKEFDEPKAEVKEITGFGVNPGYPSAGGIIGVEQYLNKHEENATLREKIKGLELEIQYMRERHEKDLERLRTDQELALKAAKDSNQMFSQGLGMLMNRMGVGE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.