NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315277_10431530

Scaffold Ga0315277_10431530


Overview

Basic Information
Taxon OID3300032118 Open in IMG/M
Scaffold IDGa0315277_10431530 Open in IMG/M
Source Dataset NameSediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1343
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Extremophilic Microbial Mat Communities From Usa And Mexico

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5099Long. (o)-110.3566Alt. (m)Depth (m)103
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004667Metagenome428Y

Sequences

Protein IDFamilyRBSSequence
Ga0315277_104315302F004667AGGMARPPKVDTVQFRRKLDNPKLQILLSAGQGNISQGFENLLSLYQHLHGIGYRTDSPLESIGLVTNLDEKKRGSSNHVNQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.