Scaffold Ga0315277_10408366

Overview

Basic Information

• Taxon OID: 3300032118
• Scaffold ID: Ga0315277_10408366
• Source Dataset Name: Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1392
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Extremophilic Microbial Mat Communities From Usa And Mexico

Source Dataset Sampling Location

• Location Name: USA: Wyoming
• Coordinates
  • Lat. (^o): 44.5099
  • Long. (^o): -110.3566
  • Depth (m): 103

Associated Families

Family	Category	Number of Sequences	3D Structure?
F105417	Metagenome	100	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0315277_104083662	F105417	GGA	MKPNPLRTLAAAAFLFWTFVAIDATATSVVPLDLDQITASAQHIVHVRCTGNEVHPDPAIGVVTVTTFVVLDRAKGAASPTFTVRQAGGELNGLAVNYHVPRFAVGDEYVLFMPAASRLGLASPVGLSQGAFGVVQGASGKEVGNGNDFARLLGGVVDSTSVPSGIAARMQGAPAERARVDLADFMTLVRAKAGPN