Scaffold Ga0315903_10010681

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0315903_10010681

Scaffold Ga0315903_10010681

Overview

Basic Information
Taxon OID	3300032116 Open in IMG/M
Scaffold ID	Ga0315903_10010681 Open in IMG/M
Source Dataset Name	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	10902
Total Scaffold Genes	17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (11.76%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Fungal Communities From Various Locations

Source Dataset Sampling Location
Location Name	USA: Lake Erie, Ohio
Coordinates	Lat. (^o)	41.7464	Long. (^o)	-83.3444	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F041189	Metagenome / Metatranscriptome	160	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0315903_100106811	F041189	N/A	TSNKGDKKTLELFISGPALDNFEGWPIDKDNPTGPKYSGQTARVGATMWTDEFSNVNVSRNEIMYKLSIIATELGLKHELDSINATTIEDWVAQVIDLVKGNNLYWFLKGTEEEYNGKTIVKLSLPKYKFVSIEEDKLEKFDKNNKYHYKALNTKPVSSFEPATDEFQM

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.