Basic Information | |
---|---|
Taxon OID | 3300032092 Open in IMG/M |
Scaffold ID | Ga0315905_11166988 Open in IMG/M |
Source Dataset Name | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 632 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Fungal Communities From Various Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Lake Erie, Ohio | |||||||
Coordinates | Lat. (o) | 41.8268 | Long. (o) | -83.1913 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F060701 | Metagenome | 132 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0315905_111669882 | F060701 | AGGAG | MIVSFMTALPVKQVEKATDWMQAMPRSVRKTLRLTKPRQRNVNTHDGVDDYLAVDCRIDTYHTQNLEFLDREFGFDEFGDIDDEHEGLTITSAMSEVEAFEYLTGYDII |
⦗Top⦘ |