| Basic Information | |
|---|---|
| Taxon OID | 3300032092 Open in IMG/M |
| Scaffold ID | Ga0315905_10502736 Open in IMG/M |
| Source Dataset Name | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1116 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Fungal Communities From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Lake Erie, Ohio | |||||||
| Coordinates | Lat. (o) | 41.8268 | Long. (o) | -83.1913 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001739 | Metagenome | 643 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0315905_105027364 | F001739 | N/A | ITAMYTLQQPDPNYVVNALWEVTGVDGTNTASIGGNTQFNSADQVGAFIPYASLTEAIVIGWIPESAITSAQQCVQGQIDSMITPPVSPANTPLPW |
| ⦗Top⦘ |