NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315905_10012522

Scaffold Ga0315905_10012522


Overview

Basic Information
Taxon OID3300032092 Open in IMG/M
Scaffold IDGa0315905_10012522 Open in IMG/M
Source Dataset NameFreshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8598
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)15 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Fungal Communities From Various Locations

Source Dataset Sampling Location
Location NameUSA: Lake Erie, Ohio
CoordinatesLat. (o)41.8268Long. (o)-83.1913Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F032962Metagenome / Metatranscriptome178Y
F032998Metagenome178N
F056345Metagenome / Metatranscriptome137N

Sequences

Protein IDFamilyRBSSequence
Ga0315905_1001252210F032962AGGAGMAALTVADTGLGASISGTSLITTQVVSIGEMTISVDSLDISSLDTAGFELLRPSDLRKNPEVDVVFNWLGAAIPFAATMIPTAEPYAGTSVTITFPGAGSLQGTAFVKEVKTPKLGKGEVMRGSYKLQFDGATDITFTPA
Ga0315905_1001252211F056345AGGAMVFVLNRQRGISLSTGVERHLNQCQIRVGGKLVGYLPLGETPQIQAIFEFPHDALTAQEIASLEKQLETIQGYPAKVHPPEQVSRSFVEAALKAVEQAKGDEDDE
Ga0315905_1001252215F032998AGCAGGMANELVGAELRKGSGFARKGQGFQLILGETWNYRVKTDQVTSNRQSILYDTPGLPRAGLLYGPLGLICDEVSCEREEKHALFWNVTARFQTGTEEQKQNSEGNDDPATWIPIFKIDSFVTKEKVLAKDRSTPTKYPVNSAGTPFDQPLTDTSSFCQFSFVQFDDPGLKLKDFLDRNDIVNTTAFTALGQTFAARTLLLEVQEAELGSYAGYAAWRAKYKVTYDPDTHDEKRADIGPFYKSGGQTLRYMDSTNTFPMVGPLNGSGAKATDPAELVFRCKKEVEFSTIIRTS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.