Basic Information | |
---|---|
Taxon OID | 3300032080 Open in IMG/M |
Scaffold ID | Ga0326721_10100636 Open in IMG/M |
Source Dataset Name | Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1381 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Marine Airborne Microbial Communities From Various Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Oklahoma | |||||||
Coordinates | Lat. (o) | 36.36 | Long. (o) | -97.29 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F040319 | Metagenome / Metatranscriptome | 162 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0326721_101006362 | F040319 | GGAG | MTNVLPSLSPVMHNIHVNVVSAEEASLGVAEFWSGDRMIGFTLIEDGDLTLRIGPSADGVVLGAHALAEALAEANRLLALH |
⦗Top⦘ |