NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0310890_10312823

Scaffold Ga0310890_10312823


Overview

Basic Information
Taxon OID3300032075 Open in IMG/M
Scaffold IDGa0310890_10312823 Open in IMG/M
Source Dataset NameLab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1134
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil → Soil Microbial Communities From West Virginia University Organic Research Farm, Morgantown, Wv, United States

Source Dataset Sampling Location
Location NameUSA: West Virginia
CoordinatesLat. (o)39.6475Long. (o)-79.9369Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F047523Metagenome / Metatranscriptome149N
F048509Metagenome / Metatranscriptome148N
F097678Metagenome / Metatranscriptome104N

Sequences

Protein IDFamilyRBSSequence
Ga0310890_103128231F047523N/AMSGFITGLKSVEEVEAGIFEVVVTLQRGATAKLRMNTFTFQAFVTKFIEGPRPQRWLDKPICLLKKIFAPLWPSRKRQ
Ga0310890_103128232F097678AGGAGMKPNPKWTAATLVVLAAATVSTMHALAIAPVPMVHESDGTSANGSKTYDEWQAPLSRSFRARFLDHRTAEDAIAGGAAGRGFTLRIFDGLEKMQIWDNAP
Ga0310890_103128233F048509N/AAATIGGVAALNPGNKPHEDVAYLERLAATVERAKVLAPDTREQLSKLTNRYETLLSDAQLDLKRQKALRRIRTVMLRSAD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.