NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315279_10000724

Scaffold Ga0315279_10000724


Overview

Basic Information
Taxon OID3300032070 Open in IMG/M
Scaffold IDGa0315279_10000724 Open in IMG/M
Source Dataset NameSediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_20
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)61034
Total Scaffold Genes47 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)43 (91.49%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Extremophilic Microbial Mat Communities From Usa And Mexico

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5094Long. (o)-110.5094Alt. (m)Depth (m)88
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F038511Metagenome / Metatranscriptome165Y

Sequences

Protein IDFamilyRBSSequence
Ga0315279_100007244F038511AGGAMALDELHARRLATVVSVVEGALDRMELVLRSLENRRGVDSSHLTEGQIRQARDKMESLRHRVNEALERFAVRLHKPEPKQVLAAELSTLWVVLENARPERMKGYGRKFTPADRAAWENLIQELLHDLEQVRCVVLAERTRSPKAIRPEAPEGNQP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.