Scaffold Ga0315282_10009227

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0315282_10009227

Scaffold Ga0315282_10009227

Overview

Basic Information
Taxon OID	3300032069 Open in IMG/M
Scaffold ID	Ga0315282_10009227 Open in IMG/M
Source Dataset Name	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_20
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	15723
Total Scaffold Genes	31 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	28 (90.32%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Extremophilic Microbial Mat Communities From Usa And Mexico

Source Dataset Sampling Location
Location Name	USA: Wyoming
Coordinates	Lat. (^o)	44.5099	Long. (^o)	-110.3581	Alt. (m)		Depth (m)	87
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F071875	Metagenome	121	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0315282_100092273	F071875	AGG	METLQPVAPDQMQVMIPHWVYNRIAALLVAAQSATEPEDYIVAVLEGHVRRLNL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.