Scaffold Ga0315282_10003000

Overview

Basic Information

• Taxon OID: 3300032069
• Scaffold ID: Ga0315282_10003000
• Source Dataset Name: Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_20
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 30535
• Total Scaffold Genes: 46
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 31 (67.39%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Candidatus Verstraetearchaeota → Candidatus Methanomethylicia → Candidatus Methanomethylicales (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Extremophilic Microbial Mat Communities From Usa And Mexico

Source Dataset Sampling Location

• Location Name: USA: Wyoming
• Coordinates
  • Lat. (^o): 44.5099
  • Long. (^o): -110.3581
  • Depth (m): 87

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078228	Metagenome	116	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0315282_1000300026	F078228	N/A	MSLPDAMKEALEKECTRRRLDTLQETIRSILAEYFKEQGLEPPDRPR