| Basic Information | |
|---|---|
| Taxon OID | 3300032062 Open in IMG/M |
| Scaffold ID | Ga0315551_10180363 Open in IMG/M |
| Source Dataset Name | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1602-90 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 878 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment → Salt Marsh Sediment Microbial Communities From The Plum Island Ecosystem Lter, Massachusetts, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Massachusetts | |||||||
| Coordinates | Lat. (o) | 42.722 | Long. (o) | -70.847 | Alt. (m) | Depth (m) | .9 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F023034 | Metagenome / Metatranscriptome | 211 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0315551_101803631 | F023034 | N/A | MNVNSLITMDYENISDWTLGQNKPNSNPIKANLQKAQMNVNSLITKDYRKKDDFIVRINKPNFVKGPK |
| ⦗Top⦘ |