| Basic Information | |
|---|---|
| Taxon OID | 3300032050 Open in IMG/M |
| Scaffold ID | Ga0315906_10328292 Open in IMG/M |
| Source Dataset Name | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1364 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (80.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Fungal Communities From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Lake Erie, Ohio | |||||||
| Coordinates | Lat. (o) | 41.7464 | Long. (o) | -83.3444 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F028423 | Metagenome / Metatranscriptome | 191 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0315906_103282925 | F028423 | N/A | MENLEKNELIQLVLFYKQKLSDTELDLLKSQLEINKLNLINLTLSKQPEKKSK |
| ⦗Top⦘ |