Scaffold Ga0315330_10234409

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0315330_10234409

Scaffold Ga0315330_10234409

Overview

Basic Information
Taxon OID	3300032047 Open in IMG/M
Scaffold ID	Ga0315330_10234409 Open in IMG/M
Source Dataset Name	Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1176
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing

Source Dataset Sampling Location
Location Name	USA: California
Coordinates	Lat. (^o)	36.7468	Long. (^o)	-122.0193	Alt. (m)		Depth (m)	40
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036279	Metagenome / Metatranscriptome	170	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0315330_102344091	F036279	N/A	KGTKTNLKIFIIISFVLLQGCSVPFANGITGKDILRLANASKNIKNITKEGASEELITETKNILRDIKNGGKAQR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.