Scaffold Ga0315330_10178636

Overview

Basic Information

• Taxon OID: 3300032047
• Scaffold ID: Ga0315330_10178636
• Source Dataset Name: Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1381
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (16.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage MEDS1 group (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 36.7468
  • Long. (^o): -122.0193
  • Depth (m): 40

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019153	Metagenome	231	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0315330_101786364	F019153	N/A	MKDDGFMKMIGSKLPPETELAVEMRCREVWACEDIEQIKAFCIDLMKNHARAEAVLSTAMMRVIELESRLSAIKTPTRKHTGIHRVRWWIEQLHLHWKYRKVTKRYSHRA