NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315316_10009972

Scaffold Ga0315316_10009972


Overview

Basic Information
Taxon OID3300032011 Open in IMG/M
Scaffold IDGa0315316_10009972 Open in IMG/M
Source Dataset NameAmmonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7125
Total Scaffold Genes19 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (52.63%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)36.7468Long. (o)-122.0193Alt. (m)Depth (m)60
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013819Metagenome / Metatranscriptome268Y
F078819Metagenome / Metatranscriptome116N

Sequences

Protein IDFamilyRBSSequence
Ga0315316_100099721F013819GAGMGKYLKINVKNNIKEFTKGLTRFQKKQVPFVAATTLTGVAFEVRKNAIEKSFPQAFKNSRVASGMARGRLRVMKANKRDYNMGMLSAKVLDKSSNPLEYLLTHQKGGMKKPKTGDYIAVPSTKIKQKLGIRRKAQWRPAVLRNKPNFKTFSKGSWVRGKSIKAIVEIKGKKMERAYSLVRSVPIPKRLFFEENAEQTVQKKIQFIWNDKLNFALRTSRYK
Ga0315316_1000997212F078819N/AVLQHTEISSEVRLWRSVLKRAILDCCGIFEDSKFNNRLATRHRIIYEAESWFNHKDDYEQVCSFANMQTYNVFELKENAKKYFKNSSQERSTLLSALLDRAFSRYYGSG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.