Scaffold Ga0310344_10011314

Overview

Basic Information

• Taxon OID: 3300032006
• Scaffold ID: Ga0310344_10011314
• Source Dataset Name: Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-200_MG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 6709
• Total Scaffold Genes: 14
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (42.86%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Comprehensive Metagenome And Single Cell Genome Sequencing From The Open Ocean Community Of North Pacfic Subtropical Gyre, Station Aloha

Source Dataset Sampling Location

• Location Name: Pacific Ocean: North Pacific Subtropical Gyre
• Coordinates
  • Lat. (^o): 22.7656
  • Long. (^o): -158.2256
  • Depth (m): 200

Associated Families

Family	Category	Number of Sequences	3D Structure?
F085588	Metagenome	111	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0310344_1001131411	F085588	N/A	MKTIKLNIKNASAGQMLTLRGELRVMAKSWKKFGPVIEVQAGKLQEPKLTKQKRNFTKW