| Basic Information | |
|---|---|
| Taxon OID | 3300032003 Open in IMG/M |
| Scaffold ID | Ga0310897_10462931 Open in IMG/M |
| Source Dataset Name | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 610 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil → Soil Microbial Communities From West Virginia University Organic Research Farm, Morgantown, Wv, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: West Virginia | |||||||
| Coordinates | Lat. (o) | 39.6475 | Long. (o) | -79.9369 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F075012 | Metagenome | 119 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0310897_104629311 | F075012 | AGGAG | MRQASCWILCLAWFASGCDGPLAVSPSAPIAGPPPPILMSPHSYRNANFQTPNVFFPIAVGDVISQRVTPQDPVCDPAWGFHCQYYRYVASREGLFEIAMAWKSLHEYPLDIDVTDPDNMTWDVTFLALNERRVQLRVKAESVYWVGIWSAEAP |
| ⦗Top⦘ |