Scaffold Ga0310786_10889244

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0310786_10889244

Scaffold Ga0310786_10889244

Overview

Basic Information
Taxon OID	3300031998 Open in IMG/M
Scaffold ID	Ga0310786_10889244 Open in IMG/M
Source Dataset Name	Bovine rumen microbial communities from tropical cattle in Woodstock, Queensland, Australia - Gonzalo_03 (v2)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	981
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Rumen Microbial Communities From Sheep, Dairy Cows And Beef Cattle From Various Locations

Source Dataset Sampling Location
Location Name	Australia: Woodstock, Queensland
Coordinates	Lat. (^o)	-19.6574	Long. (^o)	146.8351	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F091120	Metagenome / Metatranscriptome	107	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0310786_108892443	F091120	GAG	MITHDLKTIVKGSAVLDCVKAGGVAVYHITVEDGTIYSLDIDLSDKHDVGETATFMSHYDKALILMRWIRRAIDNEELYKIN

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.