Scaffold Ga0308176_10006151

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0308176_10006151

Scaffold Ga0308176_10006151

Overview

Basic Information
Taxon OID	3300031996 Open in IMG/M
Scaffold ID	Ga0308176_10006151 Open in IMG/M
Source Dataset Name	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	8024
Total Scaffold Genes	13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	6 (46.15%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil → Leaf Surface Microbial Communities From Various Plants In Uc Gill Tract Community Farm, Albany, California, United States

Source Dataset Sampling Location
Location Name	USA: California
Coordinates	Lat. (^o)	37.8864	Long. (^o)	-122.2981	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025803	Metagenome / Metatranscriptome	200	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0308176_100061516	F025803	N/A	VAVALLRRYWRWLGRWLRLSQPGRAFFTVVVLFGGAEIKFVRAQGDQEGGAPAVVLTLVLAGVVALDAAGRGVIAAARRLISGGGFRRHS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.