| Basic Information | |
|---|---|
| Taxon OID | 3300031995 Open in IMG/M |
| Scaffold ID | Ga0307409_102281454 Open in IMG/M |
| Source Dataset Name | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 571 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere → Maize Rhizosphere Microbial Communities From Greenhouse At Uc Davis, California, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: California | |||||||
| Coordinates | Lat. (o) | 38.5 | Long. (o) | -121.7 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F057180 | Metagenome | 136 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0307409_1022814541 | F057180 | AGGAG | MTRHFSLLVDDRPETLMRVTGLCLRRQADVLALRYARTRGGRTGFARLELELSVDERCGRGLAERLGALVEVRDVAELRD |
| ⦗Top⦘ |