Scaffold Ga0310694_10377088

Overview

Basic Information

• Taxon OID: 3300031992
• Scaffold ID: Ga0310694_10377088
• Source Dataset Name: Sheep rumen microbial communities from Palmerston North, Manawatu-Wanganui, New Zealand - 1742 DNA GHGhigh gp2 (v2)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1456
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Rumen Microbial Communities From Sheep, Dairy Cows And Beef Cattle From Various Locations

Source Dataset Sampling Location

• Location Name: New Zealand: Palmerston North, Manawatu-Wanganui
• Coordinates
  • Lat. (^o): -40.3794
  • Long. (^o): 175.6106

Associated Families

Family	Category	Number of Sequences	3D Structure?
F048027	Metagenome / Metatranscriptome	148	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0310694_103770881	F048027	AGGAG	MAETKKEKFSLDTRVRLVAENNGGKGVKMPVWFNLPQHKALRQQHIDICKKLVELSAANGNYPITYLVYFAVGKNAHRKEVFEDGYTNIDEKKAEKIFSWLKIAAKYHKNDKLFRNPNAAHALCRFYDKFSTKTKDFKAALERMERNPKIDLKNAKALVEGMGIGKQSKEAELEAAEGAMEPAVVNA