Scaffold Ga0318531_10226392

Overview

Basic Information

• Taxon OID: 3300031981
• Scaffold ID: Ga0318531_10226392
• Source Dataset Name: Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 843
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Lab Enrichment Of Tropical Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico

Source Dataset Sampling Location

• Location Name: Puerto Rico: Rio Grande
• Coordinates
  • Lat. (^o): 18.321
  • Long. (^o): -65.8172
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036349	Metagenome	170	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0318531_102263923	F036349	GGAGG	MKTRYTVALLLLGLVLPAGEAVGQQAGPTLHRYMVRAVLTAEGLKNLQKQPPTALKAGVAKFVESVGGKLEFWYFDYGAATAYSVID