Basic Information | |
---|---|
Taxon OID | 3300031967 Open in IMG/M |
Scaffold ID | Ga0315914_1062957 Open in IMG/M |
Source Dataset Name | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 692 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → Hologalegina → IRL clade → Trifolieae → Medicago → Medicago truncatula | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Plants → Nodule → Unclassified → Unclassified → Root Nodules → Root Nodule Microbial Communities Of Legume Samples Collected From Usa, Mexico And Botswana |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: California | |||||||
Coordinates | Lat. (o) | 34.06 | Long. (o) | -118.44 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F003802 | Metagenome | 467 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0315914_10629571 | F003802 | N/A | LLINWTLRLPWVFQFIDSKVYNIVDKTFSLPLLLKEGYVWFRGRSLLLHGISGSRLRPILDRSGGSAGAGRLMLLLVYDCF |
⦗Top⦘ |