Scaffold Ga0326597_10011965

Overview

Basic Information

• Taxon OID: 3300031965
• Scaffold ID: Ga0326597_10011965
• Source Dataset Name: Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 11454
• Total Scaffold Genes: 15
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 11 (73.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Uranium-Contaminated Sites Across The Upper Colorado River Basin Region

Source Dataset Sampling Location

• Location Name: USA: Wyoming
• Coordinates
  • Lat. (^o): 42.9888
  • Long. (^o): -108.3994
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050243	Metagenome / Metatranscriptome	145	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0326597_1001196513	F050243	GAG	MPKKMEETTILSTLQDLLIFQMALAGVPQTQIRKVVGLDMNRVNRIAKLVKKPNKNKKE