NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307479_10164506

Scaffold Ga0307479_10164506


Overview

Basic Information
Taxon OID3300031962 Open in IMG/M
Scaffold IDGa0307479_10164506 Open in IMG/M
Source Dataset NameHardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2178
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil → Hardwood Forest Soil Microbial Communities From Various Locations In The United States

Source Dataset Sampling Location
Location NameUSA: Indiana
CoordinatesLat. (o)39.0844Long. (o)-86.4705Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000624Metagenome / Metatranscriptome977Y
F000703Metagenome / Metatranscriptome928Y
F002853Metagenome / Metatranscriptome526Y
F015771Metagenome / Metatranscriptome252Y

Sequences

Protein IDFamilyRBSSequence
Ga0307479_101645061F015771N/ALFYFAESDTTPAFGAPRVYFMGASRNLYVQLGNQTLYWRAYSQYIGSLPSAPVGFGAPPIAVAGGGAAGPAPLPSSGSGVFPNGVPRGGNGFGIHPGSRIVRQTIL
Ga0307479_101645062F000703GAGVPENYEEMLIREYSEADLAALRAIHAAQGFDYALPDLRNPLFVTKLLLLDENVAPSFRAASVPLNDEAASRDAGLKPGATKERILGAAFLRLTAEAYLLLDPRAGTPRERWQWLLALHSAAERDAWQRGLEDVHAWLPPPIAQKFGKRLARLGWVRDDVWTPYCKKLMQMK
Ga0307479_101645063F002853GGAGGMGRGAQTQTRQMTDQERANIDALNQQFFGQQQQIGNTLLPQYQSILNNPGLSPADKAAVTGQSQGSLASAFDSLQQSAQNRLARTRNSAGFGELTDELARQKGIAEAGQAQQNQLAFTNTAFQRQMAALQGLSGLFGVDSNLLGRTLGIPAELLNVRNNASRGSGGGFFSALGSGLGSTLGALPGAFF
Ga0307479_101645064F000624GAGGMPAHWYAVLTAVAAAGVQFVLFLRWLHRRMRNDEITRAFVRDIATNHLPHIYNALQKIAARQGIELDDTPLVRFVDLNGHRRS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.