| Basic Information | |
|---|---|
| Taxon OID | 3300031960 Open in IMG/M |
| Scaffold ID | Ga0307272_1076222 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of freshwater viral communities from high-CO2 subsurface aquifer at Crystal Geyser, Utah, USA - CG08 (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 506 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Huberarchaea → Candidatus Huberarchaeum → Candidatus Huberarchaeum crystalense | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Subsurface Water → Freshwater Rna Viral Communities From High-co2 Subsurface Aquifer At Crystal Geyser, Utah, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Utah | |||||||
| Coordinates | Lat. (o) | 38.9383 | Long. (o) | -110.1342 | Alt. (m) | Depth (m) | 800 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F058694 | Metagenome / Metatranscriptome | 134 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0307272_10762222 | F058694 | GGAG | MVQTVRSELILAGRKKIIFEKPIVLHRIFISINTLVPPETWCESRISFDDPMFYSFYTLAGNAKYFEAKGEGISQGDVWLFNTTTGSVLYTMTEILV |
| ⦗Top⦘ |