| Basic Information | |
|---|---|
| Taxon OID | 3300031952 Open in IMG/M |
| Scaffold ID | Ga0315294_11264983 Open in IMG/M |
| Source Dataset Name | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 594 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Extremophilic Microbial Mat Communities From Usa And Mexico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Wyoming | |||||||
| Coordinates | Lat. (o) | 44.5395 | Long. (o) | -110.3891 | Alt. (m) | Depth (m) | 61 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F014117 | Metagenome / Metatranscriptome | 265 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0315294_112649832 | F014117 | N/A | MKNLNNDTVANIATGISCSSAVITFANTWQPVFSLLLAIVGIVSGLFAIRYYAKKIDALDGQE |
| ⦗Top⦘ |