| Basic Information | |
|---|---|
| Taxon OID | 3300031938 Open in IMG/M |
| Scaffold ID | Ga0308175_101388916 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 783 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil → Leaf Surface Microbial Communities From Various Plants In Uc Gill Tract Community Farm, Albany, California, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: California | |||||||
| Coordinates | Lat. (o) | 37.8864 | Long. (o) | -122.2981 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F058985 | Metagenome / Metatranscriptome | 134 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0308175_1013889161 | F058985 | N/A | MSGTPRVVIILAMSSFASARAAGRIEGLEALLSRLRRCASPAQAENLVAYALPELVDAIWATLYLSDDGGPPIVYGDDAWQHLANAAIARRMPCATRRDGVVTTAIPIFADMGVAGVLVMASAGELSEHDQRTLRLFAGMAGRAVRRPGLPVSA |
| ⦗Top⦘ |