NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0308175_100037753

Scaffold Ga0308175_100037753


Overview

Basic Information
Taxon OID3300031938 Open in IMG/M
Scaffold IDGa0308175_100037753 Open in IMG/M
Source Dataset NameSoil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4066
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil → Leaf Surface Microbial Communities From Various Plants In Uc Gill Tract Community Farm, Albany, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)37.8864Long. (o)-122.2981Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021617Metagenome / Metatranscriptome218Y

Sequences

Protein IDFamilyRBSSequence
Ga0308175_1000377532F021617GAGGMAIESTTRLCSLEATVGSLEACPEGACPFWEPGGAVLEGRCAFEELEVTADAALAGWLLEIRERLASAESTVAADAARSLFSHLLNESAE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.