Scaffold Ga0308175_100008876

Overview

Basic Information

• Taxon OID: 3300031938
• Scaffold ID: Ga0308175_100008876
• Source Dataset Name: Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 7427
• Total Scaffold Genes: 9
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (44.44%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil → Leaf Surface Microbial Communities From Various Plants In Uc Gill Tract Community Farm, Albany, California, United States

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 37.8864
  • Long. (^o): -122.2981

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028301	Metagenome	192	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0308175_1000088764	F028301	N/A	MTVGSDRLHRRRCIGFRIAFIFGILLAVINRSDWTLLAIALLGMAIVLIAYWRDCRKPRHTP