NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0326478_101093

Scaffold Ga0326478_101093


Overview

Basic Information
Taxon OID3300031914 Open in IMG/M
Scaffold IDGa0326478_101093 Open in IMG/M
Source Dataset NameEnriched hypersaline water microbial communities from Club Lake, Antarctica - Round 2 flow cytometry Nha-CFC
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterThe University of Queensland
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3654
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline Water → Antarctic Nanohaloarchaea

Source Dataset Sampling Location
Location NameClub Lake, Antarctica
CoordinatesLat. (o)-68.5417Long. (o)78.2467Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F047394Metagenome150N

Sequences

Protein IDFamilyRBSSequence
Ga0326478_1010932F047394GGAMTASTQPTETRAQTTNGSFQTDVSALQEMTERAVEILDSHGEPVTIARLVGTVVRLGARDEYRFETTVRVAQQYIDEECGGVDR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.